Web stats for 99jeeveswaydigitalmarketingservices - 99jeeveswaydigitalmarketingservices.com
4.67 Rating by ClearWebStats
99jeeveswaydigitalmarketingservices.com is 3 years 9 months 3 weeks old. This website has a #2,889,426 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 240.00 and has a daily earning of $ 1.00. While no active threats were reported recently by users, 99jeeveswaydigitalmarketingservices.com is SAFE to browse.
Traffic Report of 99jeeveswaydigitalmarketingservices
| Daily Unique Visitors: | 167 |
| Daily Pageviews: | 334 |
Estimated Valuation
| Income Per Day: | $ 1.00 |
| Estimated Worth: | $ 240.00 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Privacy: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | 2,889,426 |
| Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Where is 99jeeveswaydigitalmarketingservices.com server located?
Hosted IP Address:
35.209.245.239
Hosted Country:
US
Location Latitude:
37.4043Location Longitude:
-122.0748Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | 3 | H2 Headings: | 8 |
| H3 Headings: | 28 | H4 Headings: | 6 |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | 29 |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 35.209.245.239)
HTTP Header Analysis
HTTP/2 200
server: nginx
date: Mon, 20 Jul 2020 20:41:42 GMT
content-type: text/html; charset=UTF-8
content-length: 16529
x-cache-enabled: True
expires: Thu, 19 Nov 1981 08:52:00 GMT
cache-control: no-store, no-cache, must-revalidate
pragma: no-cache
link: <https://99jeeveswaydigitalmarketingservices.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://99jeeveswaydigitalmarketingservices.com/>; rel=shortlink
vary: Accept-Encoding
content-encoding: gzip
alt-svc: quic=":443"; ma=86400; v="43,39"
host-header: b7440e60b07ee7b8044761568fab26e8
x-proxy-cache: MISS
server: nginx
date: Mon, 20 Jul 2020 20:41:42 GMT
content-type: text/html; charset=UTF-8
content-length: 16529
x-cache-enabled: True
expires: Thu, 19 Nov 1981 08:52:00 GMT
cache-control: no-store, no-cache, must-revalidate
pragma: no-cache
link: <https://99jeeveswaydigitalmarketingservices.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://99jeeveswaydigitalmarketingservices.com/>; rel=shortlink
vary: Accept-Encoding
content-encoding: gzip
alt-svc: quic=":443"; ma=86400; v="43,39"
host-header: b7440e60b07ee7b8044761568fab26e8
x-proxy-cache: MISS
Domain Information for 99jeeveswaydigitalmarketingservices.com
| Domain Registrar: |
NAMECHEAP INC.
|
|---|---|
| Registration Date: | 2020-07-18 3 years 9 months 3 weeks ago |
| Last Modified: | 2020-07-18 3 years 9 months 3 weeks ago |
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.us73.siteground.us |
|
35.206.102.19 |
United States
|
| ns2.us73.siteground.us |
|
35.208.34.86 |
United States
|
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| 99jeeveswaydigitalmarketingservices.com | A | 14399 |
IP:35.209.245.239 |
| 99jeeveswaydigitalmarketingservices.com | NS | 86400 |
Target:ns2.us73.siteground.us |
| 99jeeveswaydigitalmarketingservices.com | NS | 86400 |
Target:ns1.us73.siteground.us |
| 99jeeveswaydigitalmarketingservices.com | SOA | 86400 |
MNAME:ns1.us73.siteground.us RNAME:root.us73.siteground.us Serial:2020071906 Refresh:3600 Retry:900 Expire:1209600 |
| 99jeeveswaydigitalmarketingservices.com | MX | 3600 |
Priority:10 Target:mx10.mailspamprotection.com |
| 99jeeveswaydigitalmarketingservices.com | MX | 3600 |
Priority:30 Target:mx30.mailspamprotection.com |
| 99jeeveswaydigitalmarketingservices.com | MX | 3600 |
Priority:20 Target:mx20.mailspamprotection.com |
| 99jeeveswaydigitalmarketingservices.com | TXT | 14400 |
TXT:v=spf1 +a +mx +a:ns1.us73.siteground.us include:_spf.mailspamprotection.com ~all |
Similarly Ranked Websites to 99jeeveswaydigitalmarketingservices
Plastic Surgery Utah - The Best Cosmetic Surgeon In Salt Lake City
Utah plastic Surgeons Dr. Barson and staff provide Utah with plastic surgery options for residents throughout Utah & Salt Lake City. Discover the best
2,889,432 
$ 240.00
My Humble Kitchen - Where Simple, Economical Cooking Brings Joy, Comfort, and Nourishment to the Family Table
2,889,438 $ 240.00
Explore Science Fiction Movies!
An insightful miscellany for tireless explorers of science fiction movies.
2,889,465 $ 240.00
Full WHOIS Lookup for 99jeeveswaydigitalmarketingservices.com
Domain Name: 99JEEVESWAYDIGITALMARKETINGSERVICES.COM
Registry Domain ID: 2546840250_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2020-07-18T00:31:53Z
Creation Date: 2020-07-18T00:24:46Z
Registry Expiry Date: 2021-07-18T00:24:46Z
Registrar: NameCheap, Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.6613102107
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.US73.SITEGROUND.US
Name Server: NS2.US73.SITEGROUND.US
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-07-20T20:41:33Z
Registry Domain ID: 2546840250_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2020-07-18T00:31:53Z
Creation Date: 2020-07-18T00:24:46Z
Registry Expiry Date: 2021-07-18T00:24:46Z
Registrar: NameCheap, Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.6613102107
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.US73.SITEGROUND.US
Name Server: NS2.US73.SITEGROUND.US
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-07-20T20:41:33Z